Home Accessibility Courses Twitter The Mouth Facebook Resources Site Map About Us Contact
 
For 2023 (and 2024 ...) - we are now fully retired from IT training.
We have made many, many friends over 25 years of teaching about Python, Tcl, Perl, PHP, Lua, Java, C and C++ - and MySQL, Linux and Solaris/SunOS too. Our training notes are now very much out of date, but due to upward compatability most of our examples remain operational and even relevant ad you are welcome to make us if them "as seen" and at your own risk.

Lisa and I (Graham) now live in what was our training centre in Melksham - happy to meet with former delegates here - but do check ahead before coming round. We are far from inactive - rather, enjoying the times that we are retired but still healthy enough in mind and body to be active!

I am also active in many other area and still look after a lot of web sites - you can find an index ((here))
Converting codons via Amino Acids to Proteins in Perl

DNA is the code of life - a double helix, comprising just four different basic codon elements:
  • Adenine (A)
  • Thymine (T)
  • Guanine (G)
  • Cytosine (c)
and a huge amount of work has gone into analysing these for the genes right across all types of life - including human genes. I understand (but I'm not an expert) that human DNA consists of a string of some 11 billions elements. So it's qute a data handling job to look after this lot and to extract data ... a good way to do that extraction is using the Practical Extraction and Reporting Language (Perl).

Codons are grouped in threes - GGT is one of several codes for the amino acid Glycine, for example; there are around 20 amino acids, and there is a code letter for each of them. G for Glycine, for example.

A group of amino acids then combines to form a protein, with the proteins in any particular DNA string being separated by particular 3-codon sequences with are the major break points - stop codes.

During last week's Perl course, I demonstrated Perl's data handling capability to do this conversion, writing a program from first principles - source code [here]. The conversion of sets of 3 codons to Amino acids uses an unchanging table of data across all sequences, so I've included it within the code file (at the end, not mixed with program lines!). But the sequences will vary - so they're read from separate files; there's an example [here] in industry standard fasta format.

  munchkin:a12perl grahamellis$ perl bacon
  GWG
 
  RCSWRSSGLEQRSRLAATFPRQSARPGRG
 
  APHRRVPRGCSSSGAARGSRWGLGAGPALQDGHSAVSFACLLGQGPEARRAARGEEEGAA
  RGGRGAGGLRGAASGQGRQRREPTQAAVRAHLGAHLEAPGGRVRQEEERQQEGDTQAGIH
  GPRPPGPATQPREPSPQGPGSPRRRRHRQAPGGASAHRARGCRHLRATVGGQRGRSAAGL
  GRGKASAAASPSPAGGAAGAWRLAAAGHRAGVHRRAAALSGRLRVPTLLSPQGAEPGRAG
  GLVPRCGPLAAAAGLARPGLHYACKPGVRVPAVPRVAAWGRAGVGRRAAGRLPHLPLPRL
  LLHGQRDLLPTQALPRGARQGALLAALPAPHPAAQPADAAAQRRPPLLHAGLSRPQERGR
  GRRQRRGPTERGRARRLLGRQGQLRGRNQALDYEPGPLGIPRGRAHPPPQPLTHTRTPRD
  HKATAAVTAAQRPGWAEEETPMPLRGKWRPGHQRPRCLDLLGVEWGRKMSAGKALQPHSS
  RLSAPPFLHFCRGLPLPFSPFPLGFIHFLASFLCLHFSSCLHSSLSLSLSLLFLSFFLPL
  PAFPFSVPWVCVSASPSYPLPDCTP
 
  TPVSPPAPVSPSALLVAPVMCHHLPSCLPSSSTCVSLHFFIPD
 
  VTTPLSPDQREY
 
  FLIWID
 
  GARRNCSPRYPDSHQDGPSPHPHRLSPPFPTCCMLGAGGCGGRGCRLLSGG
 
  GLEAKSTWETTPAAAPQWTGGRKRKLLTLEEGHPASLSLAFLLLLPTAPFNLFGCLRREGGGG
 
  AGPGTVRGAELGRDRNPPGRVPGTELGLGPCPRCQ
 
  CGPTERAALSVCPSVPERTIKRWKRL
  munchkin:a12perl grahamellis$


There are many standard Perl modules that can help with this sort of thing - so you may not want to write your own from scratch (remember - "if you think someone may have done it before, they probably have, and they have probably released the code open source")

If you want to learn how to do it for yourself - perhaps you're researching onwards from these fundamentals - take a look at our range of Perl courses - taking you through from the basics right through to modules on the specialist techniques you might want to employ to handle the huge data sets involved.
(written 2012-04-25, updated 2012-04-28)

 
Associated topics are indexed as below, or enter http://melksh.am/nnnn for individual articles
P669 - Perl - Data Munging
  [597] Storing a regular expression in a perl variable - (2006-02-09)
  [1316] Filtering and altering Perl lists with grep and map - (2007-08-23)
  [1509] Extracting information from a file of records - (2008-01-16)
  [1947] Perl substitute - the e modifier - (2008-12-16)
  [2129] Nothing beats Perl to solve a data manipulation requirement quickly - (2009-04-14)
  [2702] First and last match with Regular Expressions - (2010-04-02)
  [3335] Practical Extraction and Reporting - (2011-06-26)
  [3764] Shell, Awk, Perl of Python? - (2012-06-14)
  [4620] Perl 6 - a Practical Extraction and Reporting example! - (2016-01-11)

P212 - Perl - More on Character Strings
  [453] Commenting Perl regular expressions - (2005-09-30)
  [583] Remember to process blank lines - (2006-01-31)
  [586] Perl Regular Expressions - finding the position and length of the match - (2006-02-02)
  [608] Don't expose your regular expressions - (2006-02-15)
  [737] Coloured text in a terminal from Perl - (2006-05-29)
  [928] C++ and Perl - why did they do it THAT way? - (2006-11-16)
  [943] Matching within multiline strings, and ignoring case in regular expressions - (2006-11-25)
  [1222] Perl, the substitute operator s - (2007-06-08)
  [1230] Commenting a Perl Regular Expression - (2007-06-12)
  [1251] Substitute operator / modifiers in Perl - (2007-06-28)
  [1305] Regular expressions made easy - building from components - (2007-08-16)
  [1336] Ignore case in Regular Expression - (2007-09-08)
  [1510] Handling Binary data (.gif file example) in Perl - (2008-01-17)
  [1727] Equality and looks like tests - Perl - (2008-07-29)
  [1735] Finding words and work boundaries (MySQL, Perl, PHP) - (2008-08-03)
  [2230] Running a piece of code is like drinking a pint of beer - (2009-06-11)
  [2379] Making variables persistant, pretending a database is a variable and other Perl tricks - (2009-08-27)
  [2657] Want to do a big batch edit? Nothing beats Perl! - (2010-03-01)
  [2801] Binary data handling with unpack in Perl - (2010-06-10)
  [2834] Teaching examples in Perl - third and final part - (2010-06-27)
  [2874] Unpacking a Perl string into a list - (2010-07-16)
  [2877] Further more advanced Perl examples - (2010-07-19)
  [2993] Arrays v Lists - what is the difference, why use one or the other - (2010-10-10)
  [3059] Object Orientation in an hour and other Perl Lectures - (2010-11-18)
  [3100] Looking ahead and behind in Regular Expressions - double matching - (2010-12-23)
  [3322] How much has Perl (and other languages) changed? - (2011-06-10)
  [3332] DNA to Amino Acid - a sample Perl script - (2011-06-24)
  [3411] Single and double quotes strings in Perl - what is the difference? - (2011-08-30)
  [3546] The difference between dot (a.k.a. full stop, period) and comma in Perl - (2011-12-09)
  [3630] Serialsing and unserialising data for storage and transfer in Perl - (2012-02-28)
  [3650] Possessive Regular Expression Matching - Perl, Objective C and some other languages - (2012-03-12)
  [3927] First match or all matches? Perl Regular Expressions - (2012-11-19)
  [4452] Binary data handling - Python and Perl - (2015-03-09)


Back to
An exciting Chamber of Commerce AGM - sound like an Oxymoron?
Previous and next
or
Horse's mouth home
Forward to
Strawberry Cream Teas in Melksham - available every day this summer
Some other Articles
Kiss
Encouraging business in Melksham and its neighbourhood - keep business local??
Queen to visit eight Wiltshire areas - will she know what she misses in the other 13 areas?
Strawberry Cream Teas in Melksham - available every day this summer
Converting codons via Amino Acids to Proteins in Perl
An exciting Chamber of Commerce AGM - sound like an Oxymoron?
Django Training Courses - UK
The Bowerhill Villager - a newsletter for Bowerhill, Melksham
A Museum for Melksham History. Open from 12th May 2012.
Digital Champions think that Well House Manor is a champion venue!
4759 posts, page by page
Link to page ... 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96 at 50 posts per page


This is a page archived from The Horse's Mouth at http://www.wellho.net/horse/ - the diary and writings of Graham Ellis. Every attempt was made to provide current information at the time the page was written, but things do move forward in our business - new software releases, price changes, new techniques. Please check back via our main site for current courses, prices, versions, etc - any mention of a price in "The Horse's Mouth" cannot be taken as an offer to supply at that price.

Link to Ezine home page (for reading).
Link to Blogging home page (to add comments).

You can Add a comment or ranking to this page

© WELL HOUSE CONSULTANTS LTD., 2025: 48 Spa Road • Melksham, Wiltshire • United Kingdom • SN12 7NY
PH: 01144 1225 708225 • EMAIL: info@wellho.net • WEB: http://www.wellho.net • SKYPE: wellho

PAGE: http://www.wellho.net/mouth/3707_Con ... -Perl.html • PAGE BUILT: Sun Oct 11 16:07:41 2020 • BUILD SYSTEM: JelliaJamb